PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_07607A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family LBD
Protein Properties Length: 269aa    MW: 28535 Da    PI: 6.6218
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_07607AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260129.31.7e-4061051100
                     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklq 84 
                                +CaaCk+lrrkC+++Cv+apyfp ++p+kfanvhk+FGasnv+k+l++lp+++r da++sl++eA+ar+rdPvyG+v+ i+ lq
  Oropetium_20150105_07607A   6 PCAACKLLRRKCTQGCVFAPYFPPDSPAKFANVHKVFGASNVSKILSDLPQHQRGDAVASLAFEADARLRDPVYGCVSYISILQ 89 
                                7*********************************************************************************** PP

                     DUF260  85 qqleqlkaelallkee 100
                                 +++++++e++++++e
  Oropetium_20150105_07607A  90 LRMSEVREEINAARKE 105
                                ***********99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.3785106IPR004883Lateral organ boundaries, LOB
PfamPF031954.1E-406103IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MSSSSPCAAC KLLRRKCTQG CVFAPYFPPD SPAKFANVHK VFGASNVSKI LSDLPQHQRG  60
DAVASLAFEA DARLRDPVYG CVSYISILQL RMSEVREEIN AARKELAGYI GPAAFAPIVT  120
AAPQYHIPVV QYANAHMHQQ QQMLHLQQQH HHHHQMAEAQ QIAAAVEVNS EQGTIMRQTS  180
VYMHGASGSG GGGATVAVVP PEAGLAYDGG FLLQQQPASQ SQTTVALTYQ MESSPPPSSS  240
GLSPPEELSH QQHTDASDEG SGGVAQPA*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012704292.16e-91PREDICTED: LOB domain-containing protein 6
TrEMBLK4ADE86e-91K4ADE8_SETIT; Uncharacterized protein
STRINGSi036905m2e-90(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61433456
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.12e-55ASYMMETRIC LEAVES 2-like 1